Transporter (Fragment)

UniProt : Q63323, UniProt ID: Q63323_RAT,

Transporter (Fragment)

Rattus norvegicus

MAVAHGPVATSSPEQNGAVPSEATKKDQNLTRGNWGNQIEFVLTSVGYAWGLGNVWRFPY
LCYRNGG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Transporter (Fragment) contains a PF00209 domain.

Transporter (Fragment) is proteolytically cut by calpain-2 (C02.002) cleavage. EQNG-AVPS.

Transporter (Fragment) is proteolytically cut by calpain-2 (C02.002) cleavage. QNLT-RGNW.