ORF1a polyprotein

UniProt : Q6V7I1, UniProt ID: Q6V7I1_EAV,

ORF1a polyprotein

Equine arteritis virus

MATYSATGFGGSFVRDWSLDLPAACEHGAGLCCEVDGSTLCAECFRGCEGVEQCPGLFMG
LLKLASPVPVGHKFLIGWYRAAKVTGRYNFLELLQHPAFAQLRVVDARLAIEEASVFFSI
DHASAKRFPGARFALTPVYANAWVVSPAANSLIVTVDLEQDGFCWLKLLPPDRREAGLRL
YYNHYREQRTGWLSKTGLRLWLGDLGLGVNASSGGLKFHIMRSSPQRAWHITTRSCKLKS
YYVCDISEADWSCLPSGNYGGYNPPGDGACGYRCLAYMNGANAVSAGCSSDLWCDDELAY
RVFQLSPTFTVTIPGGRVCPNAKYVMICDKQHWRVKHAKGVGLCFDENCFRGTCNCQRKS
GPPPAPVAASVLDHILEAATFGNVRVVAADEKQRPVPAPRTRPSPTPSEGAVSDPATTPP
VPKPRTKLAKPSAPQAPTPAPRTRLQSASPQKSSVGNSDTPELAPKWRVTKTVCSYAECL
RTGLIQRARSFGDVLTQALPCKAPAVQRYTMTLKMMRSRFSWHCDTWYPLAVIACLLPIW
PSLALLVSLAIGLVPSIGNNVVLMALLVASANYVASMDHQCEGAACLSLLEEEHYYRAVR
WRPITGALSLVLNLLGQVGYVARSTFDAAYVPCTVFDLCSFAVLYLCRNRCWRCFGRCVR
VGPATHVLGSTGQRVSKLALLDLCDHFSKPTVDVVGMASGWSGCYTGTNPMERQCATTVD
PHSFDQKKAGAIVYLTPPVNSGSALQCLNVMWKRPIGSTVLGEQTGAVVTAVKSISFPPP
CCVSTTLPTRPGVTVVDHALYNRLTASGVDPALLRVGQGDFLKLNPGFRLIGGWIYGICY
FVLVVVSTFTCLPIKCGIGTRDPFCRRVFSVPVVRTQEHCHAGMCASAEGISLDSLGLTQ
LQSYWIAAVTCGLVVLLVCHRLAISALDLLTLASPLVLLVFPWAAVGLLLATSLAGAAVK
MQLVATLFVNLFFPQATLVTMGYWACVAALAVYSLMGLRVKVNVPMCVTPAHFLLLARSA
GQTREQMLRVSAAAPSNSLLGVARDCYVTGTTRLYIPKEGGMVFEGLFRSPKARGNVGFV
AGSSYGTGSVWTRNNEVVVLTASHVVGRANMATLKIGDTMLTLTFKKNGDFAEAVTTQTE
LPGNWPQLTFAQPTTGPASWCTATGDEEGLLSGEVCLAWTTSGDSGSAVVQGDAVVGVHT
GSNTSGVAYVTTPSGKLLGADTVTLSSLSKHFTGPLTQIPKDIPDNIIADVDAVPRSLAM
LIDGLSNRESSLSGPQLLLIACFMWSYLNQPTFLPYVLGFFAANFFLPKSIGRPVVTGLL
WLCSLFTPLSMRLCLFHLVCATVTGNVVSLWFYITAAGTSYLSEMWFGGYPTMLFVPRFL
VYQFPGWAIGIVLAVCSVTMLAAALGHTLLLEVFSASGRFDRTFMMKYFLEGGVRESVTA
SVTRAYGKPITQESLTATLAALTDDDFQFLSDVLDCRVVRSAMNLRAALTSFQVAQYRNI
LNASLQVDRDAARSRRLMAKLADFAVEQEVSAGDRVVVIDGLDRMAHFKDDLVLVPLTTK
VVGGSRCTICDVVKEEANDAPVKPVPSRRRRKGLPKGAQLEWDRHQEEKRGAGDDDFAVS
NDYVKRVPKYWDPNDTRGTTVKIAGTTYQKVVDYSGNVHYVEHQEDLVDYVLGKGSYECL
DQDKVLDLTNMLKVDPTELSAKDKAKARQLAHLLLDLANPVEAVNQLN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

ORF1a polyprotein contains a PF05412 domain.

ORF1a polyprotein contains a PF05579 domain.

ORF1a polyprotein is proteolytically cut by equine arterivirus Nsp2-type cysteine peptidase (C33.001) cleavage. RLIG-GWIY.

ORF1a polyprotein is proteolytically cut by equine arteritis virus-type cysteine peptidase (C32.001) cleavage. GNYG-GYNP.