Interleukin 1 beta
|
UniProt : P10749, Q2M4J6, UniProt ID: IL1B_MOUSE, Q2M4J6_MOUSE, Interleukin 1 beta Mus musculus MATVPELNCEMPPFDSDENDLFFEVDGPQKMKGCFQTFDLGCPDESIQLQISQQHINKSF RQAVSLIVAVEKLWQLPVSFPWTFQDEDMSTFFSFIFEEEPILCDSWDDDDNLLVCDVPI RQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLK GKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYIS TSQAEHKPVFLGNNSGQDIIDFTMESVSS The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Interleukin 1 beta contains a PF00340 domain.
Interleukin 1 beta contains a PF02394 domain.
Interleukin 1 beta is proteolytically cut by caspase-1 (C14.001) cleavage. LVCD-VPIR.