Encephalomyocarditis virus

MATTMEQETCAHSLTFEECPKCSALQYRNGFYLLKYDEEWYPEELLTDGEDDVFDPELDM
EVVFELQGNSTSSDKNNSSSEGNEGVIINNFYSNQYQNSIDLSANAAGSDPPRTYGQFSN
LLSGAVNAFSNMLPLLADQNTEEMENLSDRVSQDTAGNTVTNTQSTVGRLVGYGTVHDGE
HPASCADTASEKILAVERYYTFKVNDWTSTQKPFEYIRIPLPHVLSGEDGGVFGAALRRH
YLVKTGWRVQVQCNASQFHAGSLLVFMAPEYPTLDAFAMDNRWSKDNLPNGTRTQTNKKG
PFAMDHQNFWQWTLYPHQFLNLRTNTTVDLEVPYVNIAPTSSWTQHASWTLVIAVVAPLT
YSTGASTSLDITASIQPVRPVFNGLRHETLSRQSPIPVTIREHAGTWYSTLPDSTVPIYG
KTPVAPSNYMVGEYKDFLEIAQIPTFIGNKIPNAVPYIEASNTAVKTQPLATYQVTLSCS
CLANTFLAALSRNFAQYRGSLVYTFVFTGTAMMKGKFLIAYTPPGAGKPTSRDQAMQATY
AIWDLGLNSSYSFTVPFISPTHFRMVGTDQVNITNADGWVTVWQLTPLTYPPGCPTSAKI
LTMVSAGKDFSLKMPISPAPWSPQGVENAEKGVTENTDATADFVAQPVYLPENQTKVAFF
YDRSSPIGAFTVKSGSLESGFAPFSNGTCPNSVILTPGPQFDPAYDQLRPQRLTEIWGNG
NEETSKVFPLKSKQDYSFCLFSPFVYYKCDLEVTLSPHTSGNHGLLVRWCPTGTPTKPTT
QVLHEVSSLSEGRTPQVYSAGPGISNQISFVVPYNSPLSVLPAVWYNGHKRFDNTGSLGI
APNSDFGTLFFAGTKPDIKFTVYLRYKNMRVFCPRPTVFFPWPTSGDKIDMTPRAGVLML
ESPNALDISRTYPTLHVLIQFNHRGLEVRLFRHGQFWAETRADVILRSKTKQVSFLSNGN
YPSMDSRAPWNPWKNTYQAVLRAEPCRVTMDIYYKRVRPFRLPLVQKEWPVREENVFGLY
RIFNAHYAGYFADLLIHDIETNPGPFMFRPRKQVFQTQGAAVSSMAQTLLPNDLASKAMG
SAFTALLDANEDAQKAMKIIKTLSSLSDAWENVKETLNNPEFWKQLLSRCVQLIAGMTIA
VMHPDPLTLLCLGTLTAAEITSQTSLCEEIAAKFKTIFITPPPRFPTISLFQQQSPLKQV
NDIFSLAKNLDWAVKTVEKVVDWFGTWIVQEEKEQTLDQLLQRFPEHAKRISDLRNGMAA
YVECKESFDFFEKLYNQAVKEKRTGIAAVCEKFRQKHDHATARCEPVVIVLRGDAGQGKS
LSSQVIAQAVSKTIFGRQSVYSLPPDSDFFDGYENQFAAIMDDLGQNPDGSDFTTFCQMV
STTNFLPNMASLERKGTPFTSQLVVATTNLPEFRPVTIAHYPAVERRITFDYSVSAGPVC
SKTEAGYKVLDVERAFRPTGEAPLPCFQNNCLFLEKAGLQFRDNRTKEIISLVDVIERAV
ARIERKKKVLTTVQTLVAQAPVDEVSFHSVVQQLKARQEATDEQLEELQEAFAKVQERNS
VFSDWLKISAMLCAATLALSQVVKMAKAVKQMVKPDLVRVQLDEQEQGPYNETARVKPKT
LQLLDIQGPNPVMDFEKYVAKHVTAPIGFVYPTGVSTQTCLLVRGRTLVVNRHMAESDWT
SIVVRGVTHARSTVKILAIAKAGKETDVSFIRLSSGPLFRDNTSKFVKAGDVLPTGAAPV
TGIMNTDIPMMYTGTFLKAGVSVPVETGQTFNHCIHYKANTRKGWCGSALLADLGGSKKI
LGIHSAGSMGIAAASIVSQEMIRAVVNAFEPQGALERLPDGPRIHVPRKTALRPTVARQV
FQPAYAPAVLSKFDPRTEADVDEVAFSKHTSNQESLPPVFRMVAKEYANRVFTLLGKDNG
RLTVKQALEGLEGMDPMDRNTSPGLPYTALGMRRTDVVDWESATLIPFAAERLRKMNEGD
FSEVVYQTFLKDELRPIEKVQAAKTRIVDVPPFEHCILGRQLLGKFASKFQTQPGLELGS
AIGCDPDVHWTAFGVAMQGFERVYDVDYSNFDSTHSVAMFRLLAEEFFTPENGFDPLTRE
YLESLAISTHAFEEKRFLITGGLPSGCAATSMLNTIMNNIIIRAGLYLTYKNFEFDDVKV
LSYGDDLLVATNYQLDFDKVRASLAKTGYKITPANKTSTFPLNSTLEDVVFLKRKFKKEG
PLYRPVMNREALEAMLSYYRPGTLSEKLTSITMLAVHSGKQEYDRLFAPFREVGVVVPSF
ESVEYRWRSLFW

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by cardiovirus picornain 3C (C03.009) cleavage. FELQ-GNST.

is proteolytically cut by cardiovirus picornain 3C (C03.009) cleavage. WSPQ-GVEN.

is proteolytically cut by cardiovirus picornain 3C (C03.009) cleavage. LSRQ-SPIP.

is proteolytically cut by cardiovirus picornain 3C (C03.009) cleavage. FEPQ-GALE.

is proteolytically cut by cardiovirus picornain 3C (C03.009) cleavage. LDIQ-GPNP.

is proteolytically cut by cardiovirus picornain 3C (C03.009) cleavage. EQEQ-GPYN.

is proteolytically cut by cardiovirus picornain 3C (C03.009) cleavage. LVAQ-GPVD.

is proteolytically cut by cardiovirus picornain 3C (C03.009) cleavage. FQQQ-SPLK.

is proteolytically cut by cardiovirus picornain 3C (C03.009) cleavage. FQTQ-GAAV.