cDNA FLJ78465, highly similar to Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), mRNA (Catenin (Cadherin-associated protein), beta 1, 88kDa, isoform CRA_a)

UniProt : A8K1L7, P35222, UniProt ID: A8K1L7_HUMAN, CTNB1_HUMAN,

cDNA FLJ78465, highly similar to Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), mRNA (Catenin (Cadherin-associated protein), beta 1, 88kDa, isoform CRA_a)

Homo sapiens

MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ78465, highly similar to Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), mRNA (Catenin (Cadherin-associated protein), beta 1, 88kDa, isoform CRA_a) contains a PF02985 domain.

cDNA FLJ78465, highly similar to Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), mRNA (Catenin (Cadherin-associated protein), beta 1, 88kDa, isoform CRA_a) contains a PF00514 domain.

cDNA FLJ78465, highly similar to Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), mRNA (Catenin (Cadherin-associated protein), beta 1, 88kDa, isoform CRA_a) contains a PF00514 domain.

cDNA FLJ78465, highly similar to Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), mRNA (Catenin (Cadherin-associated protein), beta 1, 88kDa, isoform CRA_a) contains a PF00514 domain.

cDNA FLJ78465, highly similar to Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), mRNA (Catenin (Cadherin-associated protein), beta 1, 88kDa, isoform CRA_a) contains a PF00514 domain.

cDNA FLJ78465, highly similar to Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), mRNA (Catenin (Cadherin-associated protein), beta 1, 88kDa, isoform CRA_a) contains a PF00514 domain.

cDNA FLJ78465, highly similar to Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), mRNA (Catenin (Cadherin-associated protein), beta 1, 88kDa, isoform CRA_a) contains a PF00514 domain.

cDNA FLJ78465, highly similar to Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), mRNA (Catenin (Cadherin-associated protein), beta 1, 88kDa, isoform CRA_a) is proteolytically cut by caspase () cleavage. TQFD-AAHP.

cDNA FLJ78465, highly similar to Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), mRNA (Catenin (Cadherin-associated protein), beta 1, 88kDa, isoform CRA_a) is proteolytically cut by caspase () cleavage. TQFD-AAHP.

cDNA FLJ78465, highly similar to Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), mRNA (Catenin (Cadherin-associated protein), beta 1, 88kDa, isoform CRA_a) is proteolytically cut by Metallopeptidases () cleavage..

cDNA FLJ78465, highly similar to Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), mRNA (Catenin (Cadherin-associated protein), beta 1, 88kDa, isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. SYLD-SGIH.

cDNA FLJ78465, highly similar to Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), mRNA (Catenin (Cadherin-associated protein), beta 1, 88kDa, isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. ADID-GQYA.

cDNA FLJ78465, highly similar to Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), mRNA (Catenin (Cadherin-associated protein), beta 1, 88kDa, isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. TQFD-AAHP.

cDNA FLJ78465, highly similar to Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), mRNA (Catenin (Cadherin-associated protein), beta 1, 88kDa, isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. YPVD-GLPD.

cDNA FLJ78465, highly similar to Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), mRNA (Catenin (Cadherin-associated protein), beta 1, 88kDa, isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. DLMD-GLPP.

cDNA FLJ78465, highly similar to Homo sapiens catenin (cadherin-associated protein), beta 1, 88kDa (CTNNB1), mRNA (Catenin (Cadherin-associated protein), beta 1, 88kDa, isoform CRA_a) is proteolytically cut by calpain-2 (C02.002) cleavage..