Eukaryotic translation initiation factor 3 subunit J

UniProt : O75822, UniProt ID: EIF3J_HUMAN,

Eukaryotic translation initiation factor 3 subunit J

Homo sapiens

MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKK
EEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRL
KKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFL
EVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDL
ADYGGYDGGYVQDYEDFM

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Eukaryotic translation initiation factor 3 subunit J contains a PF08597 domain.

Eukaryotic translation initiation factor 3 subunit J is proteolytically cut by caspase-3 (C14.003) cleavage. DLAD-YGGY.

Eukaryotic translation initiation factor 3 subunit J is proteolytically cut by caspase-3 (C14.003) cleavage. DYED-FM.