cDNA, FLJ92980, Homo sapiens lamin B1 (LMNB1), mRNA (Lamin B1, isoform CRA_b)

UniProt : B2R6J6, P20700, UniProt ID: B2R6J6_HUMAN, LMNB1_HUMAN,

cDNA, FLJ92980, Homo sapiens lamin B1 (LMNB1), mRNA (Lamin B1, isoform CRA_b)

Homo sapiens

MATATPVPPRMGSRAGGPTTPLSPTRLSRLQEKEELRELNDRLAVYIDKVRSLETENSAL
QLQVTEREEVRGRELTGLKALYETELADARRALDDTARERAKLQIELGKCKAEHDQLLLN
YAKKESDLNGAQIKLREYEAALNSKDAALATALGDKKSLEGDLEDLKDQIAQLEASLAAA
KKQLADETLLKVDLENRCQSLTEDLEFRKSMYEEEINETRRKHETRLVEVDSGRQIEYEY
KLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRI
ESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDY
EQLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVD
VEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSV
SYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVA
QRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ92980, Homo sapiens lamin B1 (LMNB1), mRNA (Lamin B1, isoform CRA_b) contains a PF00038 domain.

cDNA, FLJ92980, Homo sapiens lamin B1 (LMNB1), mRNA (Lamin B1, isoform CRA_b) contains a PF00932 domain.

cDNA, FLJ92980, Homo sapiens lamin B1 (LMNB1), mRNA (Lamin B1, isoform CRA_b) is proteolytically cut by granzyme A (S01.135) cleavage. TVSR-ASSS.

cDNA, FLJ92980, Homo sapiens lamin B1 (LMNB1), mRNA (Lamin B1, isoform CRA_b) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. TVSR-ASSS.