Kallikrein 5 splice variant 2 (Kallikrein 5, isoform CRA_a) (Kallikrein 5) (Kallikrein 5 splice variant 1)

UniProt : Q53ZR3, Q9Y337, UniProt ID: KLK5_HUMAN, Q53ZR3_HUMAN,

Kallikrein 5 splice variant 2 (Kallikrein 5, isoform CRA_a) (Kallikrein 5) (Kallikrein 5 splice variant 1)

Homo sapiens

MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARS
DDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGH
YSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPS
AGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDS
CQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Kallikrein 5 splice variant 2 (Kallikrein 5, isoform CRA_a) (Kallikrein 5) (Kallikrein 5 splice variant 1) contains a PF00089 domain.

Kallikrein 5 splice variant 2 (Kallikrein 5, isoform CRA_a) (Kallikrein 5) (Kallikrein 5 splice variant 1) is proteolytically cut by kallikrein hK5 (S01.017) cleavage. SSSR-IING.

Kallikrein 5 splice variant 2 (Kallikrein 5, isoform CRA_a) (Kallikrein 5) (Kallikrein 5 splice variant 1) is proteolytically cut by kallikrein hK14 (S01.029) cleavage. SSSR-IING.