cDNA FLJ75270, highly similar to Homo sapiens cytochrome b5 type B (outer mitochondrial membrane), mRNA

UniProt : A8K6B1, O43169, UniProt ID: A8K6B1_HUMAN, CYB5B_HUMAN,

cDNA FLJ75270, highly similar to Homo sapiens cytochrome b5 type B (outer mitochondrial membrane), mRNA

Homo sapiens

MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEE
VLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWA
YWILPIIGAVLLGFLYRYYTSESKSS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ75270, highly similar to Homo sapiens cytochrome b5 type B (outer mitochondrial membrane), mRNA contains a PF00173 domain.

cDNA FLJ75270, highly similar to Homo sapiens cytochrome b5 type B (outer mitochondrial membrane), mRNA is proteolytically cut by caspase () cleavage. SGSD-GKGQ.