Apoptosis 1 inhibitor

UniProt : Q24306, UniProt ID: IAP1_DROME,

Apoptosis 1 inhibitor

Drosophila melanogaster

MASVVADLPSYGPIAFDQVDNNTNATQLFKNNINKTRMNDLNREETRLKTFTDWPLDWLD
KRQLAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNCPLLRRRTTNNVPI
NAEALDRILPPISYDICGANDSTLEMREHAYAEGVIPMSQLIQSIGMNAVNAAGSVTGTA
APQPRVTVATHASTATQATGDVQPETCRPSAASGNYFPQYPEYAIETARLRTFEAWPRNL
KQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKLMKGQL
YIDTVAAKPVLAEEKEESSSIGGVAVASTQASEEEQQTSLSSEEAVSGDVAPSVAPTAAT
RIFNKIVEATAVATPSTNSSGSTSIPEEKLCKICYGAEYNTAFLPCGHVVACAKCASSVT
KCPLCRKPFTDVMRVYFS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Apoptosis 1 inhibitor contains a PF00653 domain.

Apoptosis 1 inhibitor contains a PF00653 domain.

Apoptosis 1 inhibitor contains a PF00097 domain.

Apoptosis 1 inhibitor is proteolytically cut by caspase Nc (Drosophila melanogaster) (C14.019) cleavage. VQPE-TCRP.

Apoptosis 1 inhibitor is proteolytically cut by caspase Nc (Drosophila melanogaster) (C14.019) cleavage. VQPE-TCRP.

Apoptosis 1 inhibitor is proteolytically cut by caspase DRONC (C14.019) cleavage. VQPE-TCRP.

Apoptosis 1 inhibitor is proteolytically cut by caspase (insect 1) (C14.015) cleavage. DQVD-NNTN.