cDNA FLJ75997, highly similar to Homo sapiens general transcription factor IIB (GTF2B), mRNA (General transcription factor IIB)

UniProt : A8K1A7, Q00403, UniProt ID: A8K1A7_HUMAN, TF2B_HUMAN,

cDNA FLJ75997, highly similar to Homo sapiens general transcription factor IIB (GTF2B), mRNA (General transcription factor IIB)

Homo sapiens

MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKA
TKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKE
ITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEI
CAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAV
ELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLF
PTDFKFDTPVDKLPQL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ75997, highly similar to Homo sapiens general transcription factor IIB (GTF2B), mRNA (General transcription factor IIB) contains a PF08271 domain.

cDNA FLJ75997, highly similar to Homo sapiens general transcription factor IIB (GTF2B), mRNA (General transcription factor IIB) contains a PF00382 domain.

cDNA FLJ75997, highly similar to Homo sapiens general transcription factor IIB (GTF2B), mRNA (General transcription factor IIB) contains a PF00382 domain.

cDNA FLJ75997, highly similar to Homo sapiens general transcription factor IIB (GTF2B), mRNA (General transcription factor IIB) is proteolytically cut by caspase () cleavage. TSVD-LITT.