Putative uncharacterized protein DKFZp666E213 (TNF receptor-associated factor 1) (cDNA, FLJ96537, Homo sapiens TNF receptor-associated factor 1 (TRAF1), mRNA)

UniProt : Q13077, Q658U1, UniProt ID: Q658U1_HUMAN, TRAF1_HUMAN,

Putative uncharacterized protein DKFZp666E213 (TNF receptor-associated factor 1) (cDNA, FLJ96537, Homo sapiens TNF receptor-associated factor 1 (TRAF1), mRNA)

Homo sapiens

MASSSGSSPRPAPDENEFPFGCPPTVCQDPKEPRALCCAGCLSENPRNGEDQICPKCRGE
DLQSISPGSRLRTQEKAHPEVAEAGIGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLL
GFMKQWKARLGCGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQH
FMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQ
QTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAK
YGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAID
AFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVETST

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein DKFZp666E213 (TNF receptor-associated factor 1) (cDNA, FLJ96537, Homo sapiens TNF receptor-associated factor 1 (TRAF1), mRNA) contains a PF00917 domain.

Putative uncharacterized protein DKFZp666E213 (TNF receptor-associated factor 1) (cDNA, FLJ96537, Homo sapiens TNF receptor-associated factor 1 (TRAF1), mRNA) is proteolytically cut by caspase-3 (C14.003) cleavage. LEVD-CYRA.

Putative uncharacterized protein DKFZp666E213 (TNF receptor-associated factor 1) (cDNA, FLJ96537, Homo sapiens TNF receptor-associated factor 1 (TRAF1), mRNA) is proteolytically cut by caspase-6 (C14.005) cleavage. LEVD-CYRA.

Putative uncharacterized protein DKFZp666E213 (TNF receptor-associated factor 1) (cDNA, FLJ96537, Homo sapiens TNF receptor-associated factor 1 (TRAF1), mRNA) is proteolytically cut by caspase-8 (C14.009) cleavage. LEVD-CYRA.

Putative uncharacterized protein DKFZp666E213 (TNF receptor-associated factor 1) (cDNA, FLJ96537, Homo sapiens TNF receptor-associated factor 1 (TRAF1), mRNA) is proteolytically cut by caspase-3 (C14.003) cleavage. LEVD-CYRA.

Putative uncharacterized protein DKFZp666E213 (TNF receptor-associated factor 1) (cDNA, FLJ96537, Homo sapiens TNF receptor-associated factor 1 (TRAF1), mRNA) is proteolytically cut by caspase-6 (C14.005) cleavage. LEVD-CYRA.

Putative uncharacterized protein DKFZp666E213 (TNF receptor-associated factor 1) (cDNA, FLJ96537, Homo sapiens TNF receptor-associated factor 1 (TRAF1), mRNA) is proteolytically cut by caspase-8 (C14.009) cleavage. LEVD-CYRA.

Putative uncharacterized protein DKFZp666E213 (TNF receptor-associated factor 1) (cDNA, FLJ96537, Homo sapiens TNF receptor-associated factor 1 (TRAF1), mRNA) is proteolytically cut by caspase-8 (C14.009) cleavage. LEVD-CYRA.

Putative uncharacterized protein DKFZp666E213 (TNF receptor-associated factor 1) (cDNA, FLJ96537, Homo sapiens TNF receptor-associated factor 1 (TRAF1), mRNA) is proteolytically cut by caspase-6 (C14.005) cleavage. LEVD-CYRA.

Putative uncharacterized protein DKFZp666E213 (TNF receptor-associated factor 1) (cDNA, FLJ96537, Homo sapiens TNF receptor-associated factor 1 (TRAF1), mRNA) is proteolytically cut by caspase-3 (C14.003) cleavage. LEVD-CYRA.