Plasma protease C1 inhibitor

UniProt : P05155, UniProt ID: IC1_HUMAN,

Plasma protease C1 inhibitor

Homo sapiens

MASRLTLLTLLLLLLAGDRASSNPNATSSSSQDPESLQDRGEGKVATTVISKMLFVEPIL
EVSSLPTTNSTTNSATKITANTTDEPTTQPTTEPTTQPTIQPTQPTTQLPTDSPTQPTTG
SFCPGPVTLCSDLESHSTEAVLGDALVDFSLKLYHAFSAMKKVETNMAFSPFSIASLLTQ
VLLGAGENTKTNLESILSYPKDFTCVHQALKGFTTKGVTSVSQIFHSPDLAIRDTFVNAS
RTLYSSSPRVLSNNSDANLELINTWVAKNTNNKISRLLDSLPSDTRLVLLNAIYLSAKWK
TTFDPKKTRMEPFHFKNSVIKVPMMNSKKYPVAHFIDQTLKAKVGQLQLSHNLSLVILVP
QNLKHRLEDMEQALSPSVFKAIMEKLEMSKFQPTLLTLPRIKVTTSQDMLSIMEKLEFFD
FSYDLNLCGLTEDPDLQVSAMQHQTVLELTETGVEAAAASAISVARTLLVFEVQQPFLFV
LWDQQHKFPVFMGRVYDPRA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Plasma protease C1 inhibitor contains a PF00079 domain.

Plasma protease C1 inhibitor is proteolytically cut by StcE peptidase (M66.001) cleavage..

Plasma protease C1 inhibitor is proteolytically cut by mannan-binding lectin-associated serine peptidase 2 (S01.229) cleavage. SVAR-TLLV.

Plasma protease C1 inhibitor is proteolytically cut by complement component activated C1r (S01.192) cleavage. SVAR-TLLV.

Plasma protease C1 inhibitor is proteolytically cut by complement component activated C1s (S01.193) cleavage. SVAR-TLLV.

Plasma protease C1 inhibitor is proteolytically cut by StcE peptidase (M66.001) cleavage..

Plasma protease C1 inhibitor is proteolytically cut by mannan-binding lectin-associated serine peptidase 2 (S01.229) cleavage. SVAR-TLLV.

Plasma protease C1 inhibitor is proteolytically cut by complement component activated C1r (S01.192) cleavage. SVAR-TLLV.

Plasma protease C1 inhibitor is proteolytically cut by complement component activated C1s (S01.193) cleavage. SVAR-TLLV.

Plasma protease C1 inhibitor is proteolytically cut by complement component activated C1s (S01.193) cleavage. SVAR-TLLV.

Plasma protease C1 inhibitor is proteolytically cut by chymase (S01.140) cleavage. KMLF-VEPI.

Plasma protease C1 inhibitor is proteolytically cut by StcE peptidase (M66.001) cleavage..

Plasma protease C1 inhibitor is proteolytically cut by mannan-binding lectin-associated serine peptidase 2 (S01.229) cleavage. SVAR-TLLV.

Plasma protease C1 inhibitor is proteolytically cut by complement component activated C1r (S01.192) cleavage. SVAR-TLLV.

Plasma protease C1 inhibitor is proteolytically cut by complement component activated C1s (S01.193) cleavage. SVAR-TLLV.

Plasma protease C1 inhibitor is proteolytically cut by complement component activated C1s (S01.193) cleavage. SVAR-TLLV.

Plasma protease C1 inhibitor is proteolytically cut by chymase (S01.140) cleavage. KMLF-VEPI.

Plasma protease C1 inhibitor is proteolytically cut by neutrophil elastase (S01.131) cleavage..

Plasma protease C1 inhibitor is proteolytically cut by StcE peptidase (M66.001) cleavage..

Plasma protease C1 inhibitor is proteolytically cut by mannan-binding lectin-associated serine peptidase 2 (S01.229) cleavage. SVAR-TLLV.

Plasma protease C1 inhibitor is proteolytically cut by complement component activated C1r (S01.192) cleavage. SVAR-TLLV.

Plasma protease C1 inhibitor is proteolytically cut by complement component activated C1s (S01.193) cleavage. SVAR-TLLV.

Plasma protease C1 inhibitor is proteolytically cut by complement component activated C1s (S01.193) cleavage. SVAR-TLLV.

Plasma protease C1 inhibitor is proteolytically cut by chymase (S01.140) cleavage. KMLF-VEPI.

Plasma protease C1 inhibitor is proteolytically cut by neutrophil elastase (S01.131) cleavage..

Plasma protease C1 inhibitor is proteolytically cut by HIV-1 retropepsin (A02.001) cleavage. SKML-FVEP.