Isoform 4 of Myelin basic protein

UniProt : P04370, Q5D096, UniProt ID: P04370-2, P04370-4, Q5D096_MOUSE,

Isoform 4 of Myelin basic protein

Mus musculus

MASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFSGDRGAPKRGSGKVPW
LKQSRSPLPSHARSRPGLCHMYKDSHTRTTHYGSLPQKSQHGRTQDENPVVHFFKNIVTP
RTPPPSQGKGRGLSLSRFSWGAEGQKPGFGYGGRASDYKSAHKGFKGAYDAQGTLSKIFK
LGGRDSRSGSPMARR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 4 of Myelin basic protein contains a PF01669 domain.

Isoform 4 of Myelin basic protein is proteolytically cut by neuropsin (S01.244) cleavage..