Isoform 9 of Myelin basic protein
|
Isoform 9 of Myelin basic protein Mus musculus MASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFSGDRGAPKRGSGKVPW LKQSRSPLPSHARSRPGLCHMYKDSHTRTTHYGSLPQKSQHGRTQDENPVVHFFKNIVTP RTPPPSQGKGAEGQKPGFGYGGRASDYKSAHKGFKGAYDAQGTLSKIFKLGGRDSRSGSP MARR The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Isoform 9 of Myelin basic protein contains a PF01669 domain.
Isoform 9 of Myelin basic protein is proteolytically cut by neuropsin (S01.244) cleavage..