Isoform 2 of Myelin basic protein S
Isoform 2 of Myelin basic protein S Rattus norvegicus MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFSGDRGAPKRGSGKD SHTRTTHYGSLPQKSQRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQK PGFGYGGRASDYKSAHKGFKGAYDAQGTLSKIFKLGGRDSRSGSPMARR The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Isoform 2 of Myelin basic protein S contains a PF01669 domain.
Isoform 2 of Myelin basic protein S is proteolytically cut by kallikrein hK6 (S01.236) cleavage..