Isoform 2 of Myelin basic protein S

UniProt : P02688, UniProt ID: P02688-2,

Isoform 2 of Myelin basic protein S

Rattus norvegicus

MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFSGDRGAPKRGSGKD
SHTRTTHYGSLPQKSQRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQK
PGFGYGGRASDYKSAHKGFKGAYDAQGTLSKIFKLGGRDSRSGSPMARR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 2 of Myelin basic protein S contains a PF01669 domain.

Isoform 2 of Myelin basic protein S is proteolytically cut by kallikrein hK6 (S01.236) cleavage..