Isoform 3 of Myelin basic protein

UniProt : P02686, UniProt ID: P02686-2, P02686-3,

Isoform 3 of Myelin basic protein

Homo sapiens

MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKV
PWLKPGRSPLPSHARSQPGLCNMYKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNI
VTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKI
FKLGGRDSRSGSPMARR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 3 of Myelin basic protein contains a PF01669 domain.

Isoform 3 of Myelin basic protein is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. VHFF-KNIV.

Isoform 3 of Myelin basic protein is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. RGLS-LSRF.

Isoform 3 of Myelin basic protein is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. RASD-YKSA.

Isoform 3 of Myelin basic protein is proteolytically cut by cathepsin G (S01.133) cleavage. LSRF-SWGA.

Isoform 3 of Myelin basic protein is proteolytically cut by cathepsin G (S01.133) cleavage. VHFF-KNIV.