RH1 protein (Fragment)

UniProt : Q8T8F1, UniProt ID: Q8T8F1_PLAFA,

RH1 protein (Fragment)

Plasmodium falciparum

LENIKNNENIFDNIQLKKKDIDDIIININNTKETYLKELNKKKMLQNKKKVDEKSEINNH
HTLQHDNQNVEQKNKIKDHNLITKPNNNSSEESHQNEQMKEQNKNILEKQTRNIKPHHVH
NHNHNHNHNHNHNHNHNQNQKD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

RH1 protein (Fragment) is proteolytically cut by rhomboid peptidase PfROM4 (S54.017) cleavage..

RH1 protein (Fragment) is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

RH1 protein (Fragment) is proteolytically cut by rhomboid peptidase PfROM4 (S54.017) cleavage..

RH1 protein (Fragment) is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

RH1 protein (Fragment) is proteolytically cut by rhomboid peptidase TgROM5 (S54.023) cleavage..