Interleukin-15 receptor subunit alpha
|
UniProt : Q60819, UniProt ID: I15RA_MOUSE, Interleukin-15 receptor subunit alpha Mus musculus MASPQLRGYGVQAIPVLLLLLLLLLLPLRVTPGTTCPPPVSIEHADIRVKNYSVNSRERY VCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQP ESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAAT MTLEPTASTSLRITEISPHSSKMTKVAISTSVLLVGAGVVMAFLAWYIKSRQPSQPCRVE VETMETVPMTVRASSKEDEDTGA The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Interleukin-15 receptor subunit alpha contains a PF00084 domain.
Interleukin-15 receptor subunit alpha is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..