FUS protein (Fusion (Involved in t(12;16) in malignant liposarcoma), isoform CRA_a) (Fusion, derived from t(12;16) malignant liposarcoma)

UniProt : P35637, Q6IBQ5, UniProt ID: FUS_HUMAN, Q6IBQ5_HUMAN,

FUS protein (Fusion (Involved in t(12;16) in malignant liposarcoma), isoform CRA_a) (Fusion, derived from t(12;16) malignant liposarcoma)

Homo sapiens

MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQ
SQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSS
SYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQD
QSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYE
PRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIES
VADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFS
GNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQ
QRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYD
RGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

FUS protein (Fusion (Involved in t(12;16) in malignant liposarcoma), isoform CRA_a) (Fusion, derived from t(12;16) malignant liposarcoma) contains a PF00076 domain.

FUS protein (Fusion (Involved in t(12;16) in malignant liposarcoma), isoform CRA_a) (Fusion, derived from t(12;16) malignant liposarcoma) contains a PF00641 domain.

FUS protein (Fusion (Involved in t(12;16) in malignant liposarcoma), isoform CRA_a) (Fusion, derived from t(12;16) malignant liposarcoma) is proteolytically cut by caspase () cleavage. DWFD-GKEF.