Cecropin (Fragment)

UniProt : Q7YXL8, UniProt ID: Q7YXL8_HYACE,

Cecropin (Fragment)

Hyalophora cecropia

LEKRKWKLFKKIEKVGQRVRDAVISAGPAVATVAQATALAKN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Cecropin (Fragment) contains a PF00272 domain.

Cecropin (Fragment) is proteolytically cut by inhA g.p. (M06.001) cleavage. KIEK-VGQR.