Parkinson disease (Autosomal recessive, early onset) 7

UniProt : B2R4Z1, Q99497, UniProt ID: B2R4Z1_HUMAN, PARK7_HUMAN,

Parkinson disease (Autosomal recessive, early onset) 7

Homo sapiens

MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLED
AKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFG
SKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQ
VKAPLVLKD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Parkinson disease (Autosomal recessive, early onset) 7 contains a PF01965 domain.

Parkinson disease (Autosomal recessive, early onset) 7 is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. TVAG-LAGK.

Parkinson disease (Autosomal recessive, early onset) 7 is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. GPTA-LLAH.