RBBP7 protein (Retinoblastoma binding protein 7, isoform CRA_a) (Retinoblastoma binding protein 7) (Fragment)

UniProt : Q16576, Q6FHQ0, UniProt ID: Q6FHQ0_HUMAN, RBBP7_HUMAN,

RBBP7 protein (Retinoblastoma binding protein 7, isoform CRA_a) (Retinoblastoma binding protein 7) (Fragment)

Homo sapiens

MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDY
ALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKI
NHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGY
GLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHES
LFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALW
DLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAED
GPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSEL
EGQGS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

RBBP7 protein (Retinoblastoma binding protein 7, isoform CRA_a) (Retinoblastoma binding protein 7) (Fragment) contains a PF00400 domain.

RBBP7 protein (Retinoblastoma binding protein 7, isoform CRA_a) (Retinoblastoma binding protein 7) (Fragment) contains a PF00400 domain.

RBBP7 protein (Retinoblastoma binding protein 7, isoform CRA_a) (Retinoblastoma binding protein 7) (Fragment) contains a PF00400 domain.

RBBP7 protein (Retinoblastoma binding protein 7, isoform CRA_a) (Retinoblastoma binding protein 7) (Fragment) contains a PF00400 domain.

RBBP7 protein (Retinoblastoma binding protein 7, isoform CRA_a) (Retinoblastoma binding protein 7) (Fragment) contains a PF00400 domain.

RBBP7 protein (Retinoblastoma binding protein 7, isoform CRA_a) (Retinoblastoma binding protein 7) (Fragment) is proteolytically cut by caspase () cleavage. SHCD-SDKG.