Complement component C9

UniProt : Q62930, UniProt ID: CO9_RAT,

Complement component C9

Rattus norvegicus

MASGVTITLAIAIFALEINAQAPEPTPREEPSADALLPIDCRMSTWSQWSQCDPCLKQRF
RSRSIEVFGQFQGKSCADALGDRQHCEPTQECEEVQENCGNDFQCETGRCIKRKLLCNGD
NDCGDFSDESDCESDPRLPCRDRVVEESELGRTAGYGINILGMDPLGTPFDNEFYNGLCD
RVRDGNTLTYYRKPWNVAFLAYETKADKNFRTENYEEQFEMFKTIVRDRTTSFNANLALK
FTITEAPIKKVGVDEVSPEKNSSKPKDSSVDFQFSYFKKENFQRLSSYLSQTKKMFLHVK
GMIQLGRFVMRNRGVMLTTTFLDDVKALPVSYEKGEYFGFLETYGTHYSSSGSLGGLYEL
IYVLDKASMKEKGVELSDVKRCLGFNLDVSLYTPLQTALEGPSLTANVNHSDCLKTGDGK
VVNISRDHIIDDVISFIRGGTRKQAVLLKEKLLRGAKTIDVNDFINWASSLDDAPALISQ
KLSPIYNLIPLTMKDAYAKKQNMEKAIEDYVNEFSARKCYPCQNGGTAILLDGQCMCSCT
IKFKGIACEISKQR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Complement component C9 contains a PF00057 domain.

Complement component C9 contains a PF00090 domain.

Complement component C9 contains a PF01823 domain.

Complement component C9 is proteolytically cut by thrombin (S01.217) cleavage. KPKD-SSVD.