cDNA FLJ40371 fis, clone TESTI2034931, highly similar to Cofilin-1 (Cofilin 1 (Non-muscle), isoform CRA_b)

UniProt : B3KUQ1, P23528, UniProt ID: B3KUQ1_HUMAN, COF1_HUMAN,

cDNA FLJ40371 fis, clone TESTI2034931, highly similar to Cofilin-1 (Cofilin 1 (Non-muscle), isoform CRA_b)

Homo sapiens

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV
GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS
KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ40371 fis, clone TESTI2034931, highly similar to Cofilin-1 (Cofilin 1 (Non-muscle), isoform CRA_b) contains a PF00241 domain.

cDNA FLJ40371 fis, clone TESTI2034931, highly similar to Cofilin-1 (Cofilin 1 (Non-muscle), isoform CRA_b) is proteolytically cut by HIV-1 retropepsin (A02.001) cleavage. VKKR-KKAV.

cDNA FLJ40371 fis, clone TESTI2034931, highly similar to Cofilin-1 (Cofilin 1 (Non-muscle), isoform CRA_b) is proteolytically cut by HIV-1 retropepsin (A02.001) cleavage. KDCR-YALY.