Pr74

UniProt : Q77YG5, UniProt ID: Q77YG5_FOAMV,

Pr74

Human spumaretrovirus

MASGSNVEEYELDVEALVVILRDRNIPRNPLHGEVIGLRLTEGWWGQIERFQMVRLILQD
DDNEPLQRPRYEVIQRAVNPHTMFMISGPLAELQLAFQDLDLPEGPLRFGPLANGHYVQG
DPYSSSYRPVTMAETAQMTRDELEDVLNTQSEIEIQMINLLELYEVETRALRRQLAERSS
TGQGGISPGAPRSRPPVSSFSGLPSLPSIPGIHPRAPSPPRATSTPGNIPWSLGDDSPPS
SSFPGPSQPRVSFHPGNPFVEEEGHRPRSQSRERRREILPAPVPSAPPMIQYIPVPPPPP
IGTVIPIQHIRSVTGEPPRNPREIPIWLGRNAPAIDGVFPVTTPDLRCRIINAILGGNIG
LSLTPGDCLTWDSAVATLFIRTHGTFPMHQLGNVIKGIVDQEGVATAYTLGMMLSGQNYQ
LVSGIIRGYLPGQAVVTALQQRLDQEIDNQTRAETFIQHLNAVYEILGLNARGQSIRASV
TPQPRPSRGRGRGQNTSRPSQGPANSGRGRQRPASGQSNRGSSTQNQNQDNLNQGGYNLR
PRTYQPQRYGGGRGRRWNDNTNNQESRPSDQGSQTPRPNQAGSGVRGNQSQTPRPAAGRG
GRGNHNRNQRSSGAGDSRAVNTVTQSATSSTDESSSAVTAASGRIKGTKLLAHWDSGATI
TCIPESFLEDEQPIKKTLIKTIHGEKQQNVYYVTFKVKGRKVEAEVIASPYEYILLSPTD
VPWLTQQPLQLTILVPLQEYQEKILSKTALPEDQKQQLKTLFVKYDNLWQHWENQVGHRK
IRPHNIATGDYPPRPQKQYPINPKAKPVYKL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Pr74 contains a PF03276 domain.

Pr74 contains a PF03539 domain.

Pr74 is proteolytically cut by spumapepsin (A09.001) cleavage. RAVN-TVTQ.