Gag protein

UniProt : Q98826, UniProt ID: Q98826_9RETR,

Gag protein

Human foamy virus

MASGSNVEEYELDVEALVVILRDRNIPRNPLHGEVIGLRLTEGWWGQIERFQMVRLILQD
DDNEPLQRPRYEVIQRAVNPHTMFMISGPLAELQLAFQDLDLPEGPLRFGPLANGHYVQG
DPYSSSYRPVTMAETAQMTRDELEDVLNTQSEIEIQMINLLELYEVETRALRRQLAERSS
TGQGGISPGAPRSRPPVSSFSGLPSLPSIPGIHPRAPSPPRATSTPGNIPWSLGDDSPPS
SSFPGPSQPRVSFHPGNPFVEEEGHRPRSQSRERRREILPAPVPSAPPMIQYIPVPPPPP
IGTVIPIQHIRSVTGEPPRNPREIPIWLGRNAPAIDGVFPVTTPDLRCRIINAILGGNIG
LSLTPGDCLTWDSAVATLFIRTHGTFPMHQLGNVIKGIVDQEGVATAYTLGMMLSGQNYQ
LVSGIIRGYLPGQAVVTALQQRLDQEIDDQTRAETFIQHLNAVYEILGLNARGQSIRASV
TPQPRPSRGRGRGQNTSRPSQGPANSGRGRQRPASGQSNRGSSTQNQNQDNLNQGGYNLR
PRTYQPQRYGGGRGRRWNDNTNNQESRPSDQGSQTPRPNQAGSGVRGNQSQTPRPAAGRG
GRGNHNRNQRSSGAGDSRAVNTVTQSATSSTDESSSAVTAASGGDQRD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Gag protein contains a PF03276 domain.

Gag protein is proteolytically cut by spumapepsin (A09.001) cleavage. HWEN-QVGH.