cDNA FLJ77556, highly similar to Homo sapiens cyclin T2 (CCNT2), transcript variant b, mRNA (Cyclin T2, isoform CRA_a)

UniProt : A8KA48, O60583, UniProt ID: A8KA48_HUMAN, CCNT2_HUMAN,

cDNA FLJ77556, highly similar to Homo sapiens cyclin T2 (CCNT2), transcript variant b, mRNA (Cyclin T2, isoform CRA_a)

Homo sapiens

MASGRGASSRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINT
AIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLEPLLDT
KCDAYLQQTQELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNS
LHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVTLELLDELTHEF
LQILEKTPNRLKKIRNWRANQAARKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPTNPS
FQKPSTSAFPAPVPLNSGNISVQDSHTSDNLSMLATGMPSTSYGLSSHQEWPQHQDSART
EQLYSQKQETSLSGSQYNINFQQGPSISLHSGLHHRPDKISDHSSVKQEYTHKAGSSKHH
GPISTTPGIIPQKMSLDKYREKRKLETLDLDVRDHYIAAQVEQQHKQGQSQAASSSSVTS
PIKMKIPIANTEKYMADKKEKSGSLKLRIPIPPTDKSASKEELKMKIKVSSSERHSSSDE
GSGKSKHSSPHISRDHKEKHKEHPSSRHHTSSHKHSHSHSGSSSGGSKHSADGIPPTVLR
SPVGLSSDGISSSSSSSRKRLHVNDASHNHHSKMSKSSKSSGSSSSSSSSVKQYISSHNS
VFNHPLPPPPPVTYQVGYGHLSTLVKLDKKPVETNGPDANHEYSTSSQHMDYKDTFDMLD
SLLSAQGMNM

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ77556, highly similar to Homo sapiens cyclin T2 (CCNT2), transcript variant b, mRNA (Cyclin T2, isoform CRA_a) contains a PF00134 domain.

cDNA FLJ77556, highly similar to Homo sapiens cyclin T2 (CCNT2), transcript variant b, mRNA (Cyclin T2, isoform CRA_a) is proteolytically cut by caspase () cleavage. DVRD-HYIA.