Signal recognition particle 72 kDa protein

UniProt : P33731, UniProt ID: SRP72_CANFA,

Signal recognition particle 72 kDa protein

Canis familiaris

MASGGSGGVSVPALWSEVNRYGQNGDFTRALKTVNKILQINKDDVTALHCKVVCLIQNGS
FKEALNVINTHTKVLANNSLSFEKAYCEYRLNRIENALKTIESANQQTDKLKELYGQVLY
RLERYDECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQSNWEKVVPENLGLQEGTHELCY
NAACALIGQGQLSQAMKILQKAEDLCRRSLSEDSDGTEEDPQAELAIIHGQMAYILQLQG
RTEEALQLYNQIIKLKPTDVGLLAVIANNIITINKDQNVFDSKKKVKLTNAEGVEFKLSK
KQLQAIEFNKALLAMYTNQAEQCRKISASLQSQSPEHLLPVLIQAAQLCREKQHTKAIEL
LQEFSDQHPENAAEIKLTMAQLKISQGNISKACLILRSIEELKHKPGMVSALVTMYSHEE
DIDSAIEVFTQAIQWYQNHQPKSSAHLSLIREAANFKLKYGRKKEAISDLEQLWKQNPKD
IHTLAQLISAYSLVDPEKAKALSKHLPSSDSMSLKVDVEALENSPGATYIRKKGGKVAGD
SQPKEQGQGDLKKKKKKKKGKLPKNYDPKVTPDPERWLPMRERSYYRGRKKGKKKDQIGK
GTQGATAGASSELDASKTVSSPPTSPRPGSAATASASTSNIIPPRHQKPAGAPATKKKQQ
QKKKKGGKGGW

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Signal recognition particle 72 kDa protein contains a PF00515 domain.

Signal recognition particle 72 kDa protein contains a PF08492 domain.

Signal recognition particle 72 kDa protein contains a PF00515 domain.

Signal recognition particle 72 kDa protein is proteolytically cut by caspase-3 (C14.003) cleavage. SELD-ASKT.