RNA polymerase sigma factor K (Fragment)

UniProt : Q45625, UniProt ID: Q45625_BACSU,

RNA polymerase sigma factor K (Fragment)

Bacillus subtilis

IVITKGGCIHPSLIRFNIYGVRIHNGNFFHDKVNNCFFIFKS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

RNA polymerase sigma factor K (Fragment) is proteolytically cut by sporulation factor SpoIVFB (M50.002) cleavage. FLVS-YVKN.