Beta-2-microglobulin

UniProt : P01887, UniProt ID: B2MG_MOUSE,

Beta-2-microglobulin

Mus musculus

MARSVTLVFLVLVSLTGLYAIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQML
KNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Beta-2-microglobulin contains a PF07654 domain.

Beta-2-microglobulin is proteolytically cut by caspase-1 (C14.001) cleavage. YAIQ-KTPQ.