At3g25070 (RPM1-interacting protein 4)

UniProt : Q2HII6, Q8GYN5, UniProt ID: Q2HII6_ARATH, RIN4_ARATH,

At3g25070 (RPM1-interacting protein 4)

Arabidopsis thaliana

MARSNVPKFGNWEAEENVPYTAYFDKARKTRAPGSKIMNPNDPEYNSDSQSQAPPHPPSS
RTKPEQVDTVRRSREHMRSREESELKQFGDAGGSSNEAANKRQGRASQNNSYDNKSPLHK
NSYDGTGKSRPKPTNLRADESPEKVTVVPKFGDWDENNPSSADGYTHIFNKVREERSSGA
NVSGSSRTPTHQSSRNPNNTSSCCCFGFGGK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

At3g25070 (RPM1-interacting protein 4) contains a PF05627 domain.

At3g25070 (RPM1-interacting protein 4) is proteolytically cut by AvrRpt2 g.p. (C70.001) cleavage. PKFG-DWDE.

At3g25070 (RPM1-interacting protein 4) is proteolytically cut by AvrRpt2 g.p. (C70.001) cleavage. PKFG-NWEA.