PMAP: SubstrateDB : cDNA FLJ75390, highly similar to Homo sapiens kallikrein 7 (chymotryptic, stratum corneum), mRNA (Kallikrein 7 (Chymotryptic, stratum corneum), isoform CRA

cDNA FLJ75390, highly similar to Homo sapiens kallikrein 7 (chymotryptic, stratum corneum), mRNA (Kallikrein 7 (Chymotryptic, stratum corneum), isoform CRA_b)

UniProt : A8K0U5, P49862, UniProt ID: A8K0U5_HUMAN, KLK7_HUMAN,

cDNA FLJ75390, highly similar to Homo sapiens kallikrein 7 (chymotryptic, stratum corneum), mRNA (Kallikrein 7 (Chymotryptic, stratum corneum), isoform CRA_b)

Homo sapiens

MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLV
NERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNS
QARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVY
KDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCK
FTKWINDTMKKHR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

cDNA FLJ75390, highly similar to Homo sapiens kallikrein 7 (chymotryptic, stratum corneum), mRNA (Kallikrein 7 (Chymotryptic, stratum corneum), isoform CRA_b) contains a PF00089 domain.

cDNA FLJ75390, highly similar to Homo sapiens kallikrein 7 (chymotryptic, stratum corneum), mRNA (Kallikrein 7 (Chymotryptic, stratum corneum), isoform CRA_b) is proteolytically cut by kallikrein hK5 (S01.017) cleavage. QGDK-IIDG.