Meprin 1 alpha

UniProt : Q91WH9, UniProt ID: Q91WH9_MOUSE,

Meprin 1 alpha

Mus musculus

MARRLGRSSSFAIMLWIQPACLLSLIFSAHIAAVSIKHLLNGSDHDTDVGEQKDIFEINL
AAGLNLFQGDILLPRTRNAMRDPSSRWKLPIPYILADNLELNAKGAILHAFEMFRLKSCV
DFKPYEGESSYIIFQKLSGCWSMIGDQQVGQNISIGEGCDFKATIEHEILHALGFFHEQS
RTDRDDYVNIWWDQIITDYEHNFNTYDDNTITDLNTPYDYESLMHYGPFSFNKNESIPTI
TTKIPEFNTIIGQLPDFSAIDLIRLNRMYNCTATHTLLDHCDFEKTNVCGMIQGTRDDAD
WAHGDSSQPEQVDHTLVGQCKGAGYFMFFNTSLGARGEAALLESRILYPKRKQQCLQFFY
KMTGSPADRFEVWVRRDDNAGKVRQLAKIQTFQGDSDHNWKIAHVTLNEEKKFRYVFLGT
KGDPGNSSGGIYLDDITLTETPCPAGVWTIRNISQILENTVKGDKLVSPRFYNSEGYGVG
VTLYPNGRITSNSGFLGLTFHLYSGDNDAILEWPVENRQAIMTILDQEADTRNRMSLTLM
FTTSKNQTSSAINGSVIWDRPSKVGVYDKDCDCFRSLDWGWGQAISHQLLKRRNFLKGDS
LIIFVDFKDLTHLNRTEVPASARSTMPRGLLLQGQESPALGESSRKAMLEESLPSSLGQR
HPSRQKRSVENTGPMEDHNWPQYFRDPCDPNPCQNEGTCVNVKGMASCRCVSGHAFFYAG
ERCQAMHVHGSLLGLLIGCIAGLIFLTFVTFSTTNGKLRQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Meprin 1 alpha contains a PF00008 domain.

Meprin 1 alpha contains a PF00629 domain.

Meprin 1 alpha contains a PF00917 domain.

Meprin 1 alpha contains a PF01400 domain.

Meprin 1 alpha is proteolytically cut by cationic trypsin (S01.127) cleavage. PRTR-NAMR.