CD27 antigen

UniProt : P26842, UniProt ID: CD27_HUMAN,

CD27 antigen

Homo sapiens

MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAA
QCDPCIPGVSFSPDHHTRPHCESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTEC
DPLPNPSLTARSSQALSPHPQPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPP
QRSLCSSDFIRILVIFSGMFLVFTLAGALFLHQRRKYRSNKGESPVEPAEPCRYSCPREE
EGSTIPIQEDYRKPEPACSP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CD27 antigen contains a PF00020 domain.

CD27 antigen contains a PF00020 domain.

CD27 antigen is proteolytically cut by gingipain K (C25.002) cleavage..

CD27 antigen is proteolytically cut by gingipain R (C25.001) cleavage..