cDNA, FLJ93443, Homo sapiens aspartylglucosaminidase (AGA), mRNA (Aspartylglucosaminidase, isoform CRA_c)

UniProt : B2R7H2, P20933, UniProt ID: ASPG_HUMAN, B2R7H2_HUMAN,

cDNA, FLJ93443, Homo sapiens aspartylglucosaminidase (AGA), mRNA (Aspartylglucosaminidase, isoform CRA_c)

Homo sapiens

MARKSNLPVLLVPFLLCQALVRCSSPLPLVVNTWPFKNATEAAWRALASGGSALDAVESG
CAMCEREQCDGSVGFGGSPDELGETTLDAMIMDGTTMDVGAVGDLRRIKNAIGVARKVLE
HTTHTLLVGESATTFAQSMGFINEDLSTSASQALHSDWLARNCQPNYWRNVIPDPSKYCG
PYKPPGILKQDIPIHKETEDDRGHDTIGMVVIHKTGHIAAGTSTNGIKFKIHGRVGDSPI
PGAGAYADDTAGAAAATGNGDILMRFLPSYQAVEYMRRGEDPTIACQKVISRIQKHFPEF
FGAVICANVTGSYGAACNKLSTFTQFSFMVYNSEKNQPTEEKVDCI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ93443, Homo sapiens aspartylglucosaminidase (AGA), mRNA (Aspartylglucosaminidase, isoform CRA_c) contains a PF01112 domain.

cDNA, FLJ93443, Homo sapiens aspartylglucosaminidase (AGA), mRNA (Aspartylglucosaminidase, isoform CRA_c) is proteolytically cut by glycosylasparaginase precursor (T02.001) cleavage. RGHD-TIGM.

cDNA, FLJ93443, Homo sapiens aspartylglucosaminidase (AGA), mRNA (Aspartylglucosaminidase, isoform CRA_c) is proteolytically cut by glycosylasparaginase precursor (T02.001) cleavage. RGHD-TIGM.