Sulfatase-modifying factor 2

UniProt : Q8NBJ7, UniProt ID: SUMF2_HUMAN,

Sulfatase-modifying factor 2

Homo sapiens

MARHGLPLLPLLSLLVGAWLKLGNGQATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVK
PFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLP
VEKAFWRQPAGPGSGIRERLEHPVLHVSWNDARAYCAWRGKRLPTEEEWEFAARGGLKGQ
VYPWGNWFQPNRTNLWQGKFPKGDKAEDGFHGVSPVNAFPAQNNYGLYDLLGNVWEWTAS
PYQAAEQDMRVLRGASWIDTADGSANHRARVTTRMGNTPDSASDNLGFRCAADAGRPPGE
L

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Sulfatase-modifying factor 2 contains a PF03781 domain.

Sulfatase-modifying factor 2 is proteolytically cut by thermolysin (M04.001) cleavage..

Sulfatase-modifying factor 2 is proteolytically cut by elastase () cleavage..