Furin-like convetase

UniProt : Q75WU0, UniProt ID: Q75WU0_BOMMO,

Furin-like convetase

Bombyx mori

MARGVLVLSILVSVLSHIETTLGHYTPTWAVHIPEGREVADAVARDHGFVNLGKIFDDHY
HFHHRSLTKRSLTPAHEHHGRLEGDSRVRWAEQQKILSRKKRDFQIISTLYSTAETRTSE
PSSSAASKRDADRKRELNTRIRGRTRSADLKFILNDPKWPHMWYLNRGGGLDMNVIPAWR
EGITGRGVVVTILDDGLETDHPDLVANYDPAASYDVNGLDPDPQPRYDVIDSNRHGTRCA
GEVAATANNSLCAVGVAFGARVGGVRMLDGDVTDVVEARSLSLNPQHVDIYSASWGPDDD
GKTVDGPGLLATRAFIEGVTKGRNGKGSIFVWASGNGGKEHDNCNCDGYTNSIWTLSISS
ATERGDVPWYSEKCSSTLAATYSSGAINENQVVTTDLHHSCTAGHTGTSASAPLAAGICA
LALQANRDLTWRDMQHIVVRTARPERLSLSGEWRINGVGRNVSHSFGYGLLDASGMVRLA
KTWRTVPPQRRCELAAPRPHRMIPPRSAIALQLAVSSCPGVNYLEHVQARISLSAARRGD
LRITLTSPAGTNVTLLAPRPHDSSHSGFNSWPFMSVHMWGENPLGEWQLEVTNEGRYMEA
GTLTQWELIFYGTETPAQEQDVSPETNSLGENSRVDTKPWTLSEPESIEEVRQNAIDDDL
ALVWHDSQTIREENPVGAGDVDTGQYAASAAGCATHAPQPPHTCIGLCLLLILLLAAEAL
PQLDLTRSRQPLRLRNCALTANLRLGVKHNVTRPPRAPCEQLITS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Furin-like convetase contains a PF00082 domain.

Furin-like convetase contains a PF01483 domain.

Furin-like convetase is proteolytically cut by furin (S08.048) cleavage. RKKR-DFQI.