Neurobin

UniProt : Q1JRP2, UniProt ID: Q1JRP2_MOUSE,

Neurobin

Mus musculus

MARGQPRRSEEQWTALQNRTECKTKIKLTRCGKITLGILTAVLAAVLIGLIAYFAACGKD
SFYYHVSFKVNNIDYDSKFAKPYSQEYMDLNKRIVSLMNETFHESKLRKQYVKAHTVQVS
KAKGKVVIHAVLKFKACYRNNVEKYWESVETTLYQKLKGQTGLLIDSSSFKFSDIAMPIA
EDLLNTCCGRRTIIHRGHKVAGGQDAEEGEWPWQASLQQNSVHRCGATLISNYWLITAAH
CFIRAANPKDWKVSFGFLLSKPQAPRAVKNIIIHENYSYPAHDNDIAVVRLSSPVLYESN
IRRACLPEATQKFPPNSDVVVTGWGTLKSDGDSPNILQKGKVKIIDNKTCNSGKAYGGMI
TPGMMCAGFLKGRVDACQGDSGGPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTY
YRDWITSKTGL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Neurobin contains a PF00089 domain.

Neurobin contains a PF01390 domain.

Neurobin is proteolytically cut by neurobin (S01.294) cleavage. RGHK-VAGG.