CD99 protein (CD99 antigen, isoform CRA_a) (Fragment)

UniProt : P14209, Q6ICV7, UniProt ID: CD99_HUMAN, Q6ICV7_HUMAN,

CD99 protein (CD99 antigen, isoform CRA_a) (Fragment)

Homo sapiens

MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVV
DGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEE
ADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQR
TLLEK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CD99 protein (CD99 antigen, isoform CRA_a) (Fragment) is proteolytically cut by gingipain R (C25.001) cleavage..

CD99 protein (CD99 antigen, isoform CRA_a) (Fragment) is proteolytically cut by gingipain K (C25.002) cleavage..