cDNA, FLJ95813, Homo sapiens proenkephalin (PENK), mRNA (Proenkephalin, isoform CRA_a)

UniProt : B2RC23, P01210, UniProt ID: B2RC23_HUMAN, PENK_HUMAN,

cDNA, FLJ95813, Homo sapiens proenkephalin (PENK), mRNA (Proenkephalin, isoform CRA_a)

Homo sapiens

MARFLTLCTWLLLLGPGLLATVRAECSQDCATCSYRLVRPADINFLACVMECEGKLPSLK
IWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPM
EPEEEANGSEILAKRYGGFMKKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEE
EVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEA
LPSDEEGESYSKEVPEMEKRYGGFMRF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ95813, Homo sapiens proenkephalin (PENK), mRNA (Proenkephalin, isoform CRA_a) contains a PF01160 domain.

cDNA, FLJ95813, Homo sapiens proenkephalin (PENK), mRNA (Proenkephalin, isoform CRA_a) is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. MEKR-YGGF.

cDNA, FLJ95813, Homo sapiens proenkephalin (PENK), mRNA (Proenkephalin, isoform CRA_a) is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. FLKR-FAEA.

cDNA, FLJ95813, Homo sapiens proenkephalin (PENK), mRNA (Proenkephalin, isoform CRA_a) is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. YQKR-YGGF.

cDNA, FLJ95813, Homo sapiens proenkephalin (PENK), mRNA (Proenkephalin, isoform CRA_a) is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. GLKR-SPQL.

cDNA, FLJ95813, Homo sapiens proenkephalin (PENK), mRNA (Proenkephalin, isoform CRA_a) is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. VSKR-YGGF.

cDNA, FLJ95813, Homo sapiens proenkephalin (PENK), mRNA (Proenkephalin, isoform CRA_a) is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. FMKK-DAEE.

cDNA, FLJ95813, Homo sapiens proenkephalin (PENK), mRNA (Proenkephalin, isoform CRA_a) is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. MEKR-YGGF.

cDNA, FLJ95813, Homo sapiens proenkephalin (PENK), mRNA (Proenkephalin, isoform CRA_a) is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. FLKR-FAEA.

cDNA, FLJ95813, Homo sapiens proenkephalin (PENK), mRNA (Proenkephalin, isoform CRA_a) is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. YQKR-YGGF.

cDNA, FLJ95813, Homo sapiens proenkephalin (PENK), mRNA (Proenkephalin, isoform CRA_a) is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. GLKR-SPQL.

cDNA, FLJ95813, Homo sapiens proenkephalin (PENK), mRNA (Proenkephalin, isoform CRA_a) is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. VSKR-YGGF.

cDNA, FLJ95813, Homo sapiens proenkephalin (PENK), mRNA (Proenkephalin, isoform CRA_a) is proteolytically cut by (C9G.013) cleavage. RGLK-RSPQ.

cDNA, FLJ95813, Homo sapiens proenkephalin (PENK), mRNA (Proenkephalin, isoform CRA_a) is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. VSKR-YGGF.