CXCL2 protein (Chemokine (C-X-C motif) ligand 2, isoform CRA_a)

UniProt : P19875, Q6FGD6, UniProt ID: MIP2A_HUMAN, Q6FGD6_HUMAN,

CXCL2 protein (Chemokine (C-X-C motif) ligand 2, isoform CRA_a)

Homo sapiens

MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSV
KVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CXCL2 protein (Chemokine (C-X-C motif) ligand 2, isoform CRA_a) contains a PF00048 domain.

CXCL2 protein (Chemokine (C-X-C motif) ligand 2, isoform CRA_a) is proteolytically cut by () cleavage. AGAP-LATE.