Rattus norvegicus

ICSLECQDLVPPSEEWETCRGFWSFLTLTASGLHGKDDLENEVALEEGYTALTKLLEPLL
KELEKGQLLTSVSEEKLRGLSSRFGNGRESELLGTDLMNDEAAQAGTLHFNEEDLRKQAK
RYGGFLRKYPKRSSEMAGDEDRGQDGDQVGHEDLYKRYGGFLRRIRPKLKWDNQKRYGGF
LRRQFKVVTRSQENPNTYSEDLDV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. VVTR-SQEN.

is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. NQKR-YGGF.

is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. LYKR-YGGF.

is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. YPKR-SSEM.

is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. QAKR-YGGF.

is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. VVTR-SQEN.

is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. LYKR-YGGF.

is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. QAKR-YGGF.