Growth-regulated alpha protein

UniProt : P09341, UniProt ID: GROA_HUMAN,

Growth-regulated alpha protein

Homo sapiens

MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV
NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Growth-regulated alpha protein contains a PF00048 domain.

Growth-regulated alpha protein is proteolytically cut by cell envelope proteinase A (S08.027) cleavage. PIVK-KIIE.

Growth-regulated alpha protein is proteolytically cut by cell envelope proteinase A (S08.027) cleavage. PIVK-KIIE.

Growth-regulated alpha protein is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. SVNV-KSPG.

Growth-regulated alpha protein is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. ATEL-RCQC.

Growth-regulated alpha protein is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage..