Putative uncharacterized protein

UniProt : Q02853, Q3UQT3, UniProt ID: MMP11_MOUSE, Q3UQT3_MOUSE,

Putative uncharacterized protein

Mus musculus

MARAACLLRAISRVLLLPLPLLLLLLLLLPSPLMARARPPESHRHHPVKKGPRLLHAALP
NTLTSVPASHWVPSPAGSSRPLRCGVPDLPDVLNARNRQKRFVLSGGRWEKTDLTYRILR
FPWQLVREQVRQTVAEALQVWSEVTPLTFTEVHEGRADIMIDFARYWHGDNLPFDGPGGI
LAHAFFPKTHREGDVHFDYDETWTIGDNQGTDLLQVAAHEFGHVLGLQHTTAAKALMSPF
YTFRYPLSLSPDDRRGIQHLYGRPQMAPTSPAPTLSSQAGTDTNEIALLEPETPPDVCET
SFDAVSTIRGELFFFKAGFVWRLRSGRLQPGYPALASRHWQGLPSPVDAAFEDAQGQIWF
FQGAQYWVYDGEKPVLGPAPLSKLGLQGSPVHAALVWGPEKNKIYFFRGGDYWRFHPRTQ
RVDNPVPRRSTDWRGVPSEIDAAFQDAEGYAYFLRGHLYWKFDPVKVKVLEGFPRPVGPD
FFDCAEPANTFR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00045 domain.

Putative uncharacterized protein contains a PF00045 domain.

Putative uncharacterized protein contains a PF00045 domain.

Putative uncharacterized protein contains a PF00045 domain.

Putative uncharacterized protein contains a PF00413 domain.

Putative uncharacterized protein is proteolytically cut by PACE4 proprotein convertase (S08.075) cleavage. RQKR-FVLS.