Secretory carrier-associated membrane protein 3

UniProt : O14828, UniProt ID: SCAM3_HUMAN,

Secretory carrier-associated membrane protein 3

Homo sapiens

MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAP
LPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRREREL
QHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLL
NFLACLASFCVETNNGAGFGLSILWVLLFTPCSFVCWYRPMYKAFRSDSSFNFFVFFFIF
FVQDVLFVLQAIGIPGWGFSGWISALVVPKGNTAVSVLMLLVALLFTGIAVLGIVMLKRI
HSLYRRTGASFQKAQQEFAAGVFSNPAVRTAAANAAAGAAENAFRAP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Secretory carrier-associated membrane protein 3 contains a PF04144 domain.

Secretory carrier-associated membrane protein 3 is proteolytically cut by caspase () cleavage. ATRD-VYNP.