CCL21 protein (Chemokine (C-C motif) ligand 21) (cDNA, FLJ92167, Homo sapiens chemokine (C-C motif) ligand 21 (CCL21), mRNA) (Efficient Chemoattractant for Lymphocytes) (Fragment)

UniProt : O00585, Q6ICR7, UniProt ID: CCL21_HUMAN, Q6ICR7_HUMAN,

CCL21 protein (Chemokine (C-C motif) ligand 21) (cDNA, FLJ92167, Homo sapiens chemokine (C-C motif) ligand 21 (CCL21), mRNA) (Efficient Chemoattractant for Lymphocytes) (Fragment)

Homo sapiens

MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIP
AILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSK
GCKRTERSQTPKGP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CCL21 protein (Chemokine (C-C motif) ligand 21) (cDNA, FLJ92167, Homo sapiens chemokine (C-C motif) ligand 21 (CCL21), mRNA) (Efficient Chemoattractant for Lymphocytes) (Fragment) contains a PF00048 domain.

CCL21 protein (Chemokine (C-C motif) ligand 21) (cDNA, FLJ92167, Homo sapiens chemokine (C-C motif) ligand 21 (CCL21), mRNA) (Efficient Chemoattractant for Lymphocytes) (Fragment) is proteolytically cut by cathepsin D (A01.009) cleavage. PKEL-WVQQ.