cDNA, FLJ96746, Homo sapiens hepsin (transmembrane protease, serine 1) (HPN),transcript variant 2, mRNA

UniProt : B2RDS4, P05981, UniProt ID: B2RDS4_HUMAN, HEPS_HUMAN,

cDNA, FLJ96746, Homo sapiens hepsin (transmembrane protease, serine 1) (HPN),transcript variant 2, mRNA

Homo sapiens

MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSAD
ARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCV
DEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSL
RYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYH
GGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQ
YYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCE
DSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ96746, Homo sapiens hepsin (transmembrane protease, serine 1) (HPN),transcript variant 2, mRNA contains a PF00089 domain.

cDNA, FLJ96746, Homo sapiens hepsin (transmembrane protease, serine 1) (HPN),transcript variant 2, mRNA contains a PF09272 domain.

cDNA, FLJ96746, Homo sapiens hepsin (transmembrane protease, serine 1) (HPN),transcript variant 2, mRNA is proteolytically cut by hepsin (S01.224) cleavage. PVDR-IVGG.