Enkephalin

UniProt : P04094, Q53X05, UniProt ID: PENK_RAT, Q53X05_RAT,

Enkephalin

Rattus norvegicus

MAQFLRLCIWLLALGSCLLATVQADCSQDCAKCSYRLVRPGDINFLACTLECEGQLPSFK
IWETCKDLLQVSKPEFPWDNIDMYKDSSKQDESHLLAKKYGGFMKRYGGFMKKMDELYPV
EPEEEANGGEILAKRYGGFMKKDADEGDTLANSSDLLKELLGTGDNRAKDSHQQESTNND
EDSTSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFA
ESLPSDEEGESYSKEVPEMEKRYGGFMRF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Enkephalin contains a PF01160 domain.

Enkephalin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. LAKK-YGGF.

Enkephalin is proteolytically cut by proprotein convertase 2 (S08.072) cleavage. LAKR-YGGF.

Enkephalin is proteolytically cut by proprotein convertase 2 (S08.072) cleavage. TSKR-YGGF.

Enkephalin is proteolytically cut by proprotein convertase 2 (S08.072) cleavage. LAKK-YGGF.

Enkephalin is proteolytically cut by proprotein convertase 2 (S08.072) cleavage. FMKR-YGGF.

Enkephalin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. FMKR-YGGF.

Enkephalin is proteolytically cut by proprotein convertase 2 (S08.072) cleavage. FMKK-MDEL.

Enkephalin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. FMKK-DADE.

Enkephalin is proteolytically cut by proprotein convertase 2 (S08.072) cleavage. GLKR-SPQL.

Enkephalin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. GLKR-SPQL.

Enkephalin is proteolytically cut by proprotein convertase 2 (S08.072) cleavage. LQKR-YGGF.

Enkephalin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. LQKR-YGGF.

Enkephalin is proteolytically cut by proprotein convertase 2 (S08.072) cleavage. FMRR-VGRP.

Enkephalin is proteolytically cut by proprotein convertase 2 (S08.072) cleavage. YQKR-YGGF.

Enkephalin is proteolytically cut by proprotein convertase 2 (S08.072) cleavage. FLKR-FAES.

Enkephalin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. FLKR-FAES.

Enkephalin is proteolytically cut by proprotein convertase 2 (S08.072) cleavage. MEKR-YGGF.