cDNA, FLJ93197, highly similar to Homo sapiens CDC20 cell division cycle 20 homolog (S. cerevisiae) (CDC20), mRNA

UniProt : B2R6Z6, Q12834, UniProt ID: B2R6Z6_HUMAN, CDC20_HUMAN,

cDNA, FLJ93197, highly similar to Homo sapiens CDC20 cell division cycle 20 homolog (S. cerevisiae) (CDC20), mRNA

Homo sapiens

MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTP
GKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNL
NGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPE
IRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNY
LAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEH
HVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKA
VAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGF
AQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARR
REREKASAAKSSLIHQGIR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ93197, highly similar to Homo sapiens CDC20 cell division cycle 20 homolog (S. cerevisiae) (CDC20), mRNA contains a PF00400 domain.

cDNA, FLJ93197, highly similar to Homo sapiens CDC20 cell division cycle 20 homolog (S. cerevisiae) (CDC20), mRNA contains a PF00400 domain.

cDNA, FLJ93197, highly similar to Homo sapiens CDC20 cell division cycle 20 homolog (S. cerevisiae) (CDC20), mRNA contains a PF00400 domain.

cDNA, FLJ93197, highly similar to Homo sapiens CDC20 cell division cycle 20 homolog (S. cerevisiae) (CDC20), mRNA contains a PF00400 domain.

cDNA, FLJ93197, highly similar to Homo sapiens CDC20 cell division cycle 20 homolog (S. cerevisiae) (CDC20), mRNA contains a PF00400 domain.

cDNA, FLJ93197, highly similar to Homo sapiens CDC20 cell division cycle 20 homolog (S. cerevisiae) (CDC20), mRNA contains a PF00400 domain.

cDNA, FLJ93197, highly similar to Homo sapiens CDC20 cell division cycle 20 homolog (S. cerevisiae) (CDC20), mRNA is proteolytically cut by calpain-2 (C02.002) cleavage..